PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00522.30
Common NameJCGZ_01991
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YB
Protein Properties Length: 120aa    MW: 13577.1 Da    PI: 8.4741
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00522.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB137.44e-431811797
          NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                   mk++lP nakisk+aket+qecvsefisfvtseas kc++e+ kt+ngdd++wa++ lGf+dy+epl+ yl++yre+eg++
  Jcr4S00522.30  1 MKQILPPNAKISKEAKETIQECVSEFISFVTSEASGKCRKERGKTVNGDDICWAMGALGFDDYAEPLRRYLQRYREIEGDR 81
                   9******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008083.9E-19155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471131.93E-301100IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.3E-401100IPR009072Histone-fold
PRINTSPR006157.7E-181937No hitNo description
PRINTSPR006157.7E-183856No hitNo description
PRINTSPR006157.7E-185775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MKQILPPNAK ISKEAKETIQ ECVSEFISFV TSEASGKCRK ERGKTVNGDD ICWAMGALGF  60
DDYAEPLRRY LQRYREIEGD RANQEKGSSS NNNTITEENR APLKFDPVDK RNSSRSSRPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B8e-331761792Transcription factor HapC (Eurofung)
4g92_B8e-331761792Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084241.18e-75PREDICTED: nuclear transcription factor Y subunit B-4-like
SwissprotO822483e-43NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A067KYC63e-85A0A067KYC6_JATCU; Uncharacterized protein
STRINGPOPTR_0008s22520.15e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-44nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]